High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1

Product Details
Customization: Available
Powder: Yes
Customized: Customized
Still deciding? Get samples of $ !
Request Sample
Diamond Member Since 2016

Suppliers with verified business licenses

Audited Supplier Audited Supplier

Audited by an independent third-party inspection agency

Registered Capital
500000 RMB
Plant Area
<100 square meters
  • High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
  • High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
  • High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
  • High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
  • High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
  • High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
Find Similar Products
  • Overview
  • Product Application
  • Packaging & Shipping
  • Company Profile
  • FAQ
Overview

Basic Info.

Model NO.
47931-85-1
Certification
ISO 9001
State
Solid
Purity
>99%
Transport Package
1kg/Bag
Specification
1kg/Bag
Trademark
Lonwin
Origin
China
Production Capacity
1000kg/Month

Product Description

High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1Product Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity: 98%
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity: 98%
Source: synthetic
Appearance: White Lyophilized Powder
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

Salmon calcitonin (saleatonin, SCT for short) is a polypeptide hormone composed of 32 amino acid residues. Salmon calcitonin is one of the main drugs for the treatment of osteoporosis. It is a polypeptide preparation that can reduce blood calcium and expand Vascular and central neurotransmitters have many functions.
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
Product Application

Salmon calcitonin, inhibit the activity of osteoclasts,Inhibit bone salt dissolving, prevent bone calcium release;Improve bone mineral density, effectively relieve pain symptoms;Reduce the risk of fractures;Lower blood calcium.

1. Disabled or inability to use early and late postmenopausal osteoporosis and senile osteoporosis in combination with conventional estrogen and calcium preparations.
2. Hypercalcemia secondary to bone metastasis of breast cancer, lung cancer or kidney cancer, myeloma and other malignant tumors.
3 osteoarthritis.
4. Hyperparathyroidism, lack of activity or vitamin D poisoning (including acute or chronic poisoning).
5. Painful neurotrophic or Sudeck's disease.

Packaging & Shipping

Welcome to contact us to get complete COA.
Shanghai Lonwin Chem is a leading manufacturer and supplier of chemicals in China.We develop,produce and distribute high quality pharmaceuticals, intermediates, special chemicals and other fine chemicals. 

We could give you: 
1.Best quality in your requirement 
2.Competitive price in China market 
3.Mature Technical support 
4.Professional logistic support 
All we want is win-win business. Send yr. inquiries, you will get it!


Storage:
keep container tightly closed in a dry and well-ventilated place.
Packing:25kgs/bag or 25kgs/drum

 Weight Packing
<25KG By foil-alum bag/pap/bottle
≥25kg Package: 25kg/drum/bag or as your request
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
Company Profile

High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1Lonwin Chemical Industry Group is a company committed to the contract synthesis and production of Medicine Polypeptide, Beauty Polypeptide, Customized Polypeptide, and APIs. Our company holds ISO and REACH international certifications. We have OEM processing plants with decades of cooperation in Jiangsu, Anhui, and other regions, providing a more solid foundation for the customized production services of special chemicals.Currently, our products are widely sold in North America, Europe, Japan, South Korea, and the Middle East. Customers are highly satisfied with both our products and services.

To achieve sustainable and stable development, we have established close cooperative relationships with renowned universities and institutions in China. We regularly exchange information with them and collaborate on new technology R&D.Adhering to the business philosophy of "quality first, credit first, service first, creativity first", we are striving to meet the demands of customers worldwide. We sincerely welcome your visit and business cooperation and look forward to working with you to expand the international market together!

High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
 
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1
High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1

High Purity Salmon Calcitonin Acetate Lyophilized Powder Peptide CAS 47931-85-1

FAQ
Q1: Have your Product Quality been Approved by Third Party Lab?
A: Yes, All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China. So you will be assured with Good Quality if you choose us. 

Q2: How do you treat quality complaint?
A: First of all, our QC department will do strict examination of our export products by HPLC, UV, GC,TLC and so on in order to reduce the quality problem to near zero. If there is a real quality problem ,caused by us, we will send you free goods for replacement or refund your loss.

Q3: How to cooperate with us?
A: You can contact us for cooperation through the website contact information, or contact with the salesmen in our company. We will connect you about the specific detail via email. 

Q4: Do you Accept Sample Order
A: Yes, we accept small order from 10g, 100g and 1kg for your evaluation quality of our goods.

Q5: Is there any discount?
A: Yes, for larger quantity, we always support with better price. 

Q6: How long does it take to the goods arrived?
A: It is Depending on your location. For small order, please expect 5-7 days by DHL,UPS,TNT, FEDEX, EMS. For mass order, please allow 5-8 days by Air, 20-35 days by Sea.

Q7: Do you have any reshipment policy?
A: We have good after-sale service and re-shipment policy if the parcel  lose. Our long association with  our clients has brought great benefits. We always take the upmost care in the packaging of our products. Our clients will confirm this as even they struggle to find them without help at times. But in spite of our best efforts it is still possible  will seize a small number of packages. In this circumstance we promise reship free  to establish  long term relationship.

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier